Hormona liberadora da corticotropina

Na Galipedia, a Wikipedia en galego.
Imaxe da CRH xerada por ordenador.

A hormona liberadora da corticotropina (CRH) ou corticoliberina, antes chamada factor liberador da corticotropina (CRF) é unha hormona polipeptídica hipotalámica e neurotransmisor implicada na resposta ao estrés. A súa principal función é a estimulación da síntese de ACTH na hipófise ou pituitaria. Pertence á familia dos factores liberadores da corticotropina.

A CRH é un péptido de 41 aminoácidos derivado dunha preprohormona de 191 aminoácidos codificada nun xene do cromosoma 8 humano. A CRH é segregada polo núcleo paraventricular do hipotálamo en resposta ao estrés. Na enfermidade de Alzheimer obsérvase unha marcada redución nos niveis de CRH. Ademais de ser producida polo hipotálamo, a CRH tamén se sintetiza nos tecidos periféricos, como os linfocitos T, e é amplamente expresada na placenta. Na placenta, a CRH é un marcador que determina a duración da xestación e o momento do parto. Ao comezo do parto ten lugar un incremento rápido dos niveis circulantes de CRH, o que suxire que, ademais das súas funcións metabólicas, a CRH pode actuar como un causante do parto. [1]

Accións hormonais[editar | editar a fonte]

A CRH é producida polas células parvocelulares neuroendócrinas (que están incluídas no núcleo paraventricular) do hipotálamo e libérase na eminencia media nos terminais neurosecretores destas neuronas, e pasa ao plexo de capilares primarios do sistema portal hipotalámico-hipofisario. O sistema portal transporta a CRH á adenohipófise ou pituitaria anterior, onde estimula as células corticotropas para que secreten a hormona adrenocorticotropa (corticotropina ou ACTH) e outras substancias bioloxicamente activas (β-endorfinas). A ACTH estimula a síntese de cortisol, glicocorticoides, mineralocorticoides e DHEA; polo que niveis elevados de CRH son comúns en pacientes da síndrome de Cushing (causada por un exceso de ACTH).

A CRH-(9-41) α-hélice actúa como un antagonista da CRH. [2]

Psicofarmacoloxía[editar | editar a fonte]

O antagonista do receptor da CRH-1 pexacerfont está investigándose como tratamento do trastorno de ansiedade xeneralizada en mulleres. [3] Outros antagonistas da CRH-1 como a antalarmina foron estudados en animais para o tratamento da ansiedade, depresión e outras condicións, pero non se fixeron estudos en humanos.

Ademais, no líquido cefalorraquídeo de persoas que cometeron suicidio aparecen niveis anormalmente altos de CRH. [4]

Recentes investigacións asocian a activación do receptor da CRH1 coa sensación de euforia que se produce polo consumo de alcohol. Un antagonista do receptor da CRH1, o CP-154,526, está investigándose como tratamento potencial do alcoholismo. [5][6]

A CRH no parto[editar | editar a fonte]

A CRH tamén é sintetizada pola placenta e parece determinar a duración do embarazo. [7]

Os seus niveis aumentan contra o final do embarazo xusto antes do parto, e unha teoría actual sostén que desempeña tres funcións no parto: [8]

  • Incrementa os niveis de deshidroepiandrosterona (DHEA) directamente pola acción das glándulas adrenais fetais, e indirectamente pola glándula hipófise da nai. A DHEA ten un papel na preparación e estimulación das contraccións cervicais.
  • Incrementa a dispoñibilidade de prostaglandinas nos tecidos uteroplacentarios. As prostaglandinas activan as contraccións cervicais.
  • Antes do parto pode ter un papel na inhibición das contraccións, ao aumentar os niveis de AMPc no miometrio.

En cultivo, a CRH do trofoblasto é inhibida pola proxesterona, que permanece en alta concentración durante todo o embarazo. A liberación de CRH é estimulada polos glicocorticoides e catecolaminas, as cales aumentan antes do parto levantando este bloqueo de proxesterona. [9]

Estrutura[editar | editar a fonte]

A secuencia de 41 aminoácidos da CRH foi descuberta por Vale et al. en 1981 nos carneiros. [10] A secuencia completa é (véxase o significado das letras en aminoácido):

  • SQEPPISLDLTFHLLREVLEMTKADQLAQQAHSNRKLLDIA (ovinos)

Este péptido nas ratas e nos humanos é idéntico e difire da secuencia dos ovinos só en 7 aminoácidos (en negra). [11]

  • SEEPPISLDLTFHLLREVLEMARAEQLAQQAHSNRKLMEII (homes, ratas)

Interaccións[editar | editar a fonte]

A CRH interacciona co receptor 1 da hormona liberadora da corticotropina. [12][13]

Notas[editar | editar a fonte]

  1. "Entrez Gene: CRH corticotropin releasing hormone". http://www.ncbi.nlm.nih.gov/sites/entrez?Db=gene&Cmd=ShowDetailView&TermToSearch=1392.
  2. Santos J, Saunders PR, Hanssen NP, Yang PC, Yates D, Groot JA, Perdue MH (1 August 1999). "Corticotropin-releasing hormone mimics stress-induced colonic epithelial pathophysiology in the rat". Am. J. Physiol. 277 (2 Pt 1): G391–9. PMID 10444454. http://ajpgi.physiology.org/cgi/content/abstract/277/2/G391.
  3. "Study of Pexacerfont (BMS-562086) in the Treatment of Outpatients With Generalized Anxiety Disorder". ClinicalTrials.gov. 2008-08-01. http://www.clinicaltrials.gov/ct/show/NCT00481325?order=31. Consultado o 2008-08-03.
  4. Arató M, Bánki CM, Bissette G, Nemeroff CB (1989). "Elevated CSF CRF in suicide victims". Biol. Psychiatry 25 (3): 355–9. DOI:10.1016/0006-3223(89)90183-2. PMID 2536563.
  5. "Drug Has Potential To Prevent Alcoholics From Relapsing". Science News. ScienceDaily. 2008-08-02. http://www.sciencedaily.com/releases/2008/07/080730175518.htm. Consultado o 2008-08-09.
  6. Pastor R, McKinnon CS, Scibelli AC, Burkhart-Kasch S, Reed C, Ryabinin AE, Coste SC, Stenzel-Poore MP, Phillips TJ (July 2008). "Corticotropin-releasing factor-1 receptor involvement in behavioral neuroadaptation to ethanol: a urocortin1-independent mechanism". Proc. Natl. Acad. Sci. U.S.A. 105 (26): 9070–5. DOI:10.1073/pnas.0710181105. PMC 2449366. PMID 18591672. //www.pubmedcentral.nih.gov/articlerender.fcgi?tool=pmcentrez&artid=2449366.
  7. Kimball JW (2006-06-15). "Hormones of the Hypothalamus". Kimball's Biology Pages. http://users.rcn.com/jkimball.ma.ultranet/BiologyPages/H/Hypothalamus.html#CRH. Consultado o 2008-08-03.
  8. Lye S, Challis JRG (2001). "Chapter 12: Parturition". Fetal growth and development. Cambridge University Press - Cambridge, UK. pp. 241–266. ISBN 0-521-64543-3.
  9. Jones SA, Brooks AN, Challis JR (April 1989). "Steroids modulate corticotropin-releasing hormone production in human fetal membranes and placenta". J. Clin. Endocrinol. Metab. 68 (4): 825–30. DOI:10.1210/jcem-68-4-825. PMID 2537843.
  10. Vale W, Spiess J, Rivier C, Rivier J (September 1981). "Characterization of a 41-residue ovine hypothalamic peptide that stimulates secretion of corticotropin and beta-endorphin". Science 213 (4514): 1394–7. DOI:10.1126/science.6267699. PMID 6267699. http://www.sciencemag.org/cgi/pmidlookup?view=long&pmid=6267699.
  11. Chrousos GP, Schuermeyer TH, Doppman J, Oldfield EH, Schulte HM, Gold PW, Loriaux DL (March 1985). "NIH conference. Clinical applications of corticotropin-releasing factor.". Annals of internal medicine 102 (3): 344–358. PMID 2982307. http://www.ncbi.nlm.nih.gov/pubmed/2982307.
  12. Grammatopoulos, D K; Dai Y, Randeva H S, Levine M A, Karteris E, Easton A J, Hillhouse E W (Dec. 1999). "A novel spliced variant of the type 1 corticotropin-releasing hormone receptor with a deletion in the seventh transmembrane domain present in the human pregnant term myometrium and fetal membranes". Mol. Endocrinol. (UNITED STATES) 13 (12): 2189–202. DOI:10.1210/me.13.12.2189. ISSN 0888-8809. PMID 10598591.
  13. Gottowik, J; Goetschy V, Henriot S, Kitas E, Fluhman B, Clerc R G, Moreau J L, Monsma F J, Kilpatrick G J (Oct. 1997). "Labelling of CRF1 and CRF2 receptors using the novel radioligand, [3H]-urocortin". Neuropharmacology (ENGLAND) 36 (10): 1439–46. DOI:10.1016/S0028-3908(97)00098-1. ISSN 0028-3908. PMID 9423932.

Véxase tamén[editar | editar a fonte]

Outros artigos[editar | editar a fonte]

Bibliografía[editar | editar a fonte]

  • Slominski A, Ermak G, Hwang J, et al. (1995). "Proopiomelanocortin, corticotropin releasing hormone and corticotropin releasing hormone receptor genes are expressed in human skin". FEBS Lett. 374 (1): 113–6. DOI:10.1016/0014-5793(95)01090-2. PMID 7589495.
  • Sutton SW, Behan DP, Lahrichi SL, et al. (1995). "Ligand requirements of the human corticotropin-releasing factor-binding protein". Endocrinology 136 (3): 1097–102. DOI:10.1210/en.136.3.1097. PMID 7867564.
  • Vamvakopoulos NC, Chrousos GP (1994). "Structural organization of the 5' flanking region of the human corticotropin releasing hormone gene". DNA Seq. 4 (3): 197–206. DOI:10.3109/10425179309015632. PMID 8161822.
  • Perrin MH, Donaldson CJ, Chen R, et al. (1994). "Cloning and functional expression of a rat brain corticotropin releasing factor (CRF) receptor". Endocrinology 133 (6): 3058–61. DOI:10.1210/en.133.6.3058. PMID 8243338.
  • Romier C, Bernassau JM, Cambillau C, Darbon H (1993). "Solution structure of human corticotropin releasing factor by 1H NMR and distance geometry with restrained molecular dynamics". Protein Eng. 6 (2): 149–56. DOI:10.1093/protein/6.2.149. PMID 8386360.
  • Liaw CW, Grigoriadis DE, Lovenberg TW, et al. (1997). "Localization of ligand-binding domains of human corticotropin-releasing factor receptor: a chimeric receptor approach". Mol. Endocrinol. 11 (7): 980–5. DOI:10.1210/me.11.7.980. PMID 9178757.
  • Timpl P, Spanagel R, Sillaber I, et al. (1998). "Impaired stress response and reduced anxiety in mice lacking a functional corticotropin-releasing hormone receptor 1". Nat. Genet. 19 (2): 162–6. DOI:10.1038/520. PMID 9620773.
  • Perone MJ, Murray CA, Brown OA, et al. (1998). "Procorticotrophin-releasing hormone: endoproteolytic processing and differential release of its derived peptides within AtT20 cells". Mol. Cell. Endocrinol. 142 (1–2): 191–202. DOI:10.1016/S0303-7207(98)00104-X. PMID 9783915.
  • Willenberg HS, Bornstein SR, Hiroi N, et al. (2000). "Effects of a novel corticotropin-releasing-hormone receptor type I antagonist on human adrenal function". Mol. Psychiatry 5 (2): 137–41. DOI:10.1038/sj.mp.4000720. PMID 10822340.
  • Saeed B, Fawcett M, Self C (2001). "Corticotropin-releasing hormone binding to the syncytiotrophoblast membranes". Eur. J. Clin. Invest. 31 (2): 125–30. DOI:10.1046/j.1365-2362.2001.00770.x. PMID 11168450.