Xene Hox

Na Galipedia, a Wikipedia en galego.
Saltar ata a navegación Saltar á procura

Os xenes Hox (contracción de homeobox) son un subconxunto de xenes homeóticos, que forman un grupo de xenes relacionados que controlan o plan corporal dun embrión ao longo do eixe craniocaudal. Despois de que se forman os segmentos do embrión, as proteínas Hox determinan o tipo de apéndices (por exemplo, patas, antenas e ás na mosca do vinagre) ou os diferentes tipos de vértebras (en humanos) que se forman nun segmento. As proteínas Hox confiren, por tanto, identidade segmental, pero non forman os propios segmentos.

Unha analoxía aplicable aos xenes Hox é a do papel dun director de teatro que di cales escenas deben representar os actores e en que orde. Se o director manda representar as escenas na orde incorrecta, o conxunto da obra será representada incorrectamente. De maneira similar, as mutacións nos xenes Hox poden ter como resultado a formación de partes do corpo e extremidades en lugares incorrectos do corpo. Igual que o director de teatro non actúa na obra, os xenes Hox non participan na formación das extremidades.

O produto proteico de cada xene Hox é un factor de transcrición. Cada xene Hox contén unha secuencia conservada de ADN coñecida como o homeobox. Os xenes Hox son, pois, un subconxunto dos xenes dos factores de transcrición homeobox. En moitos animais, a organización dos xenes Hox no cromosoma é a mesma que a orde da súa expresión ao longo do eixe anteroposterior do animal en desenvolvemento, polo que se di que presentan colinearidade.[1][2]

Función[editar | editar a fonte]

Os produtos dos xenes Hox son as proteínas Hox. As proteínas Hox son un subconxunto dos factores de transcrición que conteñen o homeodominio, que son proteínas con capacidade de unirse a secuencias de nucleótidos específicas do ADN chamadas amplificadores, onde activan ou reprimen xenes. A mesma proteína Hox pode actuar como represor nun xene e como activador noutro. A capacidade das proteínas Hox de unirse ao ADN dálla unha parte da proteína denominada pregamento homeodominio. O homeodominio é un dominio de unión ao ADN de 60 aminoácidos de lonxitude (codificado pola súa correspondente secuencia de ADN de 180 pares de bases, o homeobox). Esta secuencia de aminoácidos prégase formando un motivo "hélice-xiro-hélice" (é dicir, o pregamento homeodominio), que é estabilizado por unha terceira hélice. A cadea polipeptídica consenso é:[3]

           Hélice 1          Hélice 2         Hélice 3/4
         ______________    __________    _________________
RRRKRTAYTRYQLLELEKEFLFNRYLTRRRRIELAHSLNLTERHIKIWFQNRRMKWKKEN
....|....|....|....|....|....|....|....|....|....|....|....|
         10        20        30        40        50        60

Conservación[editar | editar a fonte]

Expresión dos xenes Hox nos segmentos corporais de diferentes grupos de artrópodos. Os xenes Hox 7, 8 e 9 correspóndense nestes grupos pero son desprazados (por heterocronía) en ata tres segmentos. Os segmentos con maxilípedos teñen o xene Hox 7. Os trilobites fósiles probablemente tiñan tres rexións corporais, cada unha cunha única combinación de xenes Hox.

A secuencia e función dos xenes Hox está altamente conservada. O motivo proteico homeodominio está moi conservado en especies separadadas por enormes distancias evolutivas. Ademais, os homeodominios de proteínas Hox individuais xeralmente mostran unha maior semellanza cos homeodominios doutras especies que coas proteínas codificadas por xenes adxacentes dentro do seu propio grupo Hox. Estas dúas observacións levaron a suxerir que os grupos de xenes Hox evolucionaron a partir dun só xene Hox por medio da duplicación xénica en tándem e a subseguinte diverxencia, e que un grupo de xenes Hox prototípico que contén polo meno sete xenes Hox diferentes estaba presente no antepasado común de todos os animais bilaterais.[4]

A conservación funcional das proteínas Hox pode demostrarse polo feito de que unha mosca pode funcionar perfectamente ben cunha proteína Hox de galiña en lugar do seu propio xene Hox.[5] Así, a pesar de ter un último antepasado común que viviu hai uns 670 millóns de anos,[6] as versións da mosca e galiña do mesmo xene Hox poden intercambiarse mantendo a funcionalidade.

En Drosophila[editar | editar a fonte]

Expresión dos xenes homeobox (Hox) en Drosophila melanogaster

Drosophila melanogaster é un importante modelo para comprender a xeración do plan corporal e a evolución. Os principios xerais da función e lóxica dos xenes Hox descubertos nas moscas do vinagre aplícanse a todos os organismos bilaterais, incluíndo os humanos. Drosophila, igual que todos os insectos, ten oito xenes Hox, que están agrupados en dous complexos, ambos localizados no seu cromosoma 3. O complexo Antennapedia (que non hai que confundir co xene Antp) consta de cinco xenes, que son: labial (lab), proboscipedia (pb), deformado (Dfd), peites sexuais reducidos (Scr), e Antennapedia (Antp). O complexo Bithorax complex, denominado así polo xene Ultrabithorax, consta dos tres xenes restantes: Ultrabithorax (Ubx), abdominal-A (abd-A) e abdominal-B (abd-B).

Labial[editar | editar a fonte]

O xene lab (labial) é o xene expresado na parte máis anterior do corpo. Exprésase na cabeza, principalmente no segmento intercalar (un segmento do que non colgan apéndices situado entre as antenas e a mandíbula), e tamén no tubo dixestivo medio. A perda da función de lab fai que o embrión de Drosophila non poida internalizar as estruturas da boca e a cabeza que se desenvolven inicialmente fóra do seu corpo (un proceso chamado involución da cabeza). Se hai un fallo na involución da cabeza altéranse ou elimínanse as glándulas salivares e a farinxe. O xene lab foi chamado así inicialmente porque alteraba o apéndice labial; porén, o xene lab non se expresa no segmento labial, e o apéndice labial é probablemente o resultado da ampla desorganización resultante do fallo na involución da cabeza.[7]

Proboscipedia[editar | editar a fonte]

O xene Proboscipedia (pb) é responsable da formación dos palpos labiares e maxilares. Hai algunhas probas que indican que pb interacciona con Scr.[8]

Deformed[editar | editar a fonte]

O xene Dfd (deformed, deformado) é responsable da formción dos segmentos maxilar e mandibular na cabeza da larva.[9] Os fenotipos mutantes de Dfd son similares aos do xene labial. A perda de función de Dfd no embrión orixina un fallo na involución da cabeza (ver xene labial), cunha perda das estruturas da cabeza da larva. As mutacións no adulto presentan desaparicións de partes da cabeza ou transformacións da identidade da cabeza e o tronco.[7]

Sex combs reduced[editar | editar a fonte]

O xene Scr (Sex combs reduced, peites sexuais reducidos) é responsable do desenvolvemento cefálico e torácico no embrión e no adulto de Drosophila.[10]

Antennapedia[editar | editar a fonte]

O segundo segmento torácico ou T2, desenvolve un par de patas e un par de ás. O xene Antp especifica esta identidade ao promover a formación das patas e permitir (pero sen activar directamente) a formación das ás. Unha mutación Antp dominante, causada por unha inversión cromosómica, causa que Antp se exprese no disco imaxinal antenal, polo que, en vez de formarse unha antena, o disco dá lugar a unha pata, de modo que á mosca lle crece unha pata na cabeza.

Tipo silvestre (esquerda) e mutante Antennapedia (dereita)

Ultrabithorax[editar | editar a fonte]

O terceiro segmento torácico ou T3, leva un par de patas e un par de halterios (ás reducidas que funcionan para equilibrar o voo). Ubx determina en gran medida os padróns de T3 ao repimir os xenes implicados na formación das ás. A lámina da á está composta por dúas capas de células firmemente adheridas unhas a outras, e reciben nutrientes por medio de varias veas da á. Un dos moitos xenes que reprime Ubx é o xene blistered, que activa as proteínas implicadas na adhesión célula-célula, e spalt, que determina os padróns da situación das veas da á. Nos mutantes con perda de función de Ubx, este xene xa non reprime os xenes das ás, e os halterios desenvólvense orixinando un segundo par de ás, o que produce as famosas moscas de catro ás. Cando Ubx se expresa indebidamente no segundo segmento torácico, como ocorre nas moscas con mutación no amplificador "Cbx", reprime os xenes das ás, e estas desenvólvense orixinando halterios, producindo moscas con catro halterios.

Abdominal-A[editar | editar a fonte]

En Drosophila, abd-A exprésase xunto coa maioría do abdome, desde os segmentos abdominais 1 (A1) ao A8. A expresión de abd-A é necesaria para especificar a identidade da maioría dos segmentos abdominais. Unha función principal de abd-A en insectos é reprimir a formación das extremidades. En mutantes de perda de función de abd-A os segmentos abdominais desde A2 a A8 son transformados adquirindo unha identidade máis similar a A1. Cando abd-A se expresa ectopicamente polo embrión, todos os segmentos anteriores a A4 son transformados a unha identidade abdominal como a de A4.[7] O xene abd-A tamén afecta aos padróns de xeración da cutícula no ectoderma, e aos padróns da xeración de músculo no mesoderma.[8]

Abdominal-B[editar | editar a fonte]

O xene abd-B transcríbese dando dúas formas diferentes: unha proteína reguladora e unha proteína morfoxénica. A abd-B reguladora suprime as estruturas embrionarias epidérmicas ventrais nos segmentos oitavo e noveno do abdome de Drosophila. Tanto a proteína reguladora coma a proteína morfoxenética están implicadas no desenvolvemento do segmento da cola.[8]

Clasificación das proteínas Hox[editar | editar a fonte]

As proteínas cun alto grao de similitude de secuencia considérase que mostran tamén un alto grao de semellanza funcional, é dicir, as proteínas Hox con homeodominios idénticos considérase que teñen propiedades de unón ao ADN idénticas (a menos que se coñezan secuencias adicionais que inflúan en dita unión). Para identificar o conxunto de proteínas entre dúas especies que é máis probable que teñan unha función similar, utilízanse os esquemas de clasificación. Para as proteínas Hox, existen tres esquemas de clasificción diferentes: a baseada na inferencia filoxenética, a baseada na sintenia e a baseada na similitude de secuencia.[11] Os tres esquemas de clasificación proporcionan información non concordante para as proteínas Hox expresadas no medio do eixe corporal (Hox6-8 e Antp, Ubx e abd-A). Unha aproximación combinada utiliza información baseada na inferencia filoxenética de diferentes especies e coloca os tipos de secuencia proteica na árbore filoxenética da especie. A aproximación identifica as proteínas que mellor representan a forma ancestral (Hox7 e Antp) e as proteínas que representan versións derivadas novas (ou que se perderon nun antepasado e agora están ausentes en numerosas especies).[12]

Xenes regulados por proteínas Hox[editar | editar a fonte]

Os xenes Hox actúan a moitos niveis dentro de xerarquías de xenes do desenvolvemento: no nivel "executivo" regulan xenes que á súa vez regulan grandes redes doutros xenes (como a vía xénica que forma os apéndices). Tamén regulan directamente os denominados xenes realizadores ou xenes efectores que actúan na base de ditas xerarquías para finalmente formar os tecidos, estruturas e órganos de cada segmento. A segmentación implica procesos como a morfoxénese (diferenciación das células precursoras nas súas células terminais especializadas), a estreita asociación de grupos de células con destinos similares, o perfilado de estruturas e límites entre segmentos por medio de morte celular programada e o movemento de células desde onde se orixinan primeiramente a onde finalmente funcionan, polo que non é sorprendente que os xenes diana dos xenes Hox promocionen a división celular, adhesión celular, apoptose e migración celular.[13]

Exemplos
Organismo Xene diana Función normal do xene diana Regulado por
Drosophila distal-less activa a vía xénica para a formación das extremidades ULTRABITHORAX[14]

(reprime distal-less)

distal-less activa a vía xénica para a formación das extremidades ABDOMINAL-A[14]

(reprime distal-less)

decapentaplegic desencadea cambios na forma da célula no tracto dixestivo que son necesarios para a morfoloxía visceral normal ULTRABITHORAX[15]

(activa decapentaplegic)

reaper Apoptose: a morte celular localizada crea o límite segmental entre a maxila e a mandíbula na cabeza DEFORMED[16]

(activa reaper)

decapentaplegic impide que as células de arriba cambien a posicións máis posteriores ABDOMINAL-B[15]

(reprime decapentaplegic)

Rato EphA7 Adhesión celular: causa unha estreita asociación das células na extremidade distal que formarán os ósos dos dedos, carpo e tarso HOX-A13[13]

(activa EphA7)

Cdkn1a Ciclo celular: diferenciación de células mielomonocitos en monocitos (glóbulos brancos), con detención do ciclo cellar Hox-A10[17]

(activa Cdkn1a)

Secuencias de amplificadores unidos a homeodominios[editar | editar a fonte]

A secuencia de ADN unida a proteínas homeodominio contén a secuencia de nucleótidos TAAT, e a T 5' terminal é a máis importante para a unión.[18] Esta secuencia está conservada en case todos os sitios recoñecidos por homeodominios e probablemente distínguen esas localizacións como sitios de unión ao ADN. Os pares de bases que veñen despois desta secuencia inicial utilízanse para distinguir entre proteínas homeodominio, todas as cales teñen sitios similares de recoñecemento. Por exemplo, o nucleótido que segue a secuencia TAAT é recoñecido polo aminoácido en posición 9 da proteína homeodominio. Na proteína materna Bicoid, esta posición está ocupada pola lisina, que recoñece e se une ao nucleótido G. En Antennapedia, esta posición está ocupada por glutamina, que recoñece e únese ao nucleótido A. Se a lisina en Bicoid é substituído pola glutamina, a proteína resultante recoñece os sitios amplificadores de unión de Antennapedia.[19]

Porén, todos os factores de transcrición que conteñen homeodominios, únense esencialmente á mesma secuencia de ADN. A secuencia á que se une o homeodominio da proteína Hox é só de seis nucleótidos de longo, e esa secuencia tan curta atópase aleatoriamente moitas veces por todo o xenoma, moito máis lonxe que o número real de sitios funcionais. Isto formula a cuestión, especialmente para as proteínas Hox, que producen tales cambios drásticos na morfoloxía cando se expresan indebidamente, de como cada factor de transcrición pode producir tales resultados específicos e diferentes se todos eles se unen á mesma secuencia. Un mecanismo que introduce maior especificidade de secuencia de ADN para as proteínas Hox é a unión a cofactores proteicos. Dous destes cofactores Hox son Extradenticle (Exd) e Homothorax (Hth). Exd e Hth únense ás proteínas Hox e parecen inducir cambios conformacionais na proteína Hox, que incrementan a súa especificidade.[20]

Regulación dos xenes Hox[editar | editar a fonte]

Igual que os xenes Hox regulan os xenes realizadores, eles á súa vez regúlanse a si mesmos por xenes gap e xenes de regra par, que son á súa vez regulados por ARNm subministrados pola nai. Isto ten como resultado unha fervenza de factores de transcrición: os factores maternos activan os xenes gap ou os da regra par; despois os xenes gap e da regra par activan os xenes Hox; despois, finalmente, os xenes Hox activan os xenes realizadores que causan a diferenciación dos segmentos do embrión en desenvolvemento. A regulación conséguese por medio de gradientes de concentración de proteínas, chamados campos morfoxenéticos. Por exemplo, as altas concentracións dunha proteína materna e baixas concentracións doutras encenden un conxunto específico de xenes gap ou de regra par. Nas moscas, stripe 2 no embrión está activado polas proteínas maternas Bicoid e Hunchback, pero reprimidos polas proteínas gap Giant e Kruppel. Así, stripe 2 só se forma onde hai as proteínas Bicoid e Hunchback, pero non onde hai as proteínas Giant e Kruppel.[21]

As febras de microARN localizadas en clusters Hox inhiben os xenes Hox máis anteriores ("fenómeno da prevalencia posterior"), posiblemente para afinar mellor o seu padrón de expresión.[22]

O ARN non codificante (ARNnc ou ncRNA) é abondoso nos clusters Hox. Nos humanos, pode estar presente o ARNnc 231. Un destes, HOTAIR, silencia en trans (é transcrito no cluster HOXC e inhibe os últimos xenes HOXD) uníndose a proteínas do grupo Polycomb (PRC2).[23]

A estrutura da cromatina é esencial para a transcrición pero tamén require que o cluster forme un bucle que sobresae do territorio cromosómico.[24]

En animais superiores, como os humanos, o ácido retinoico regula a expresión diferencial de xenes Hox ao longo do eixe anteroposterior.[25] Os xenes nos extremos 3' dos clusters Hox son inducidos polo ácido retinoico o que ten como resultado a expresión de dominios que se estenden máis anteriormente no corpo comparados cos xenes Hox 5', que non son inducidos polo ácido retinoico, o que produce a expresión de dominios que permanecen en posición máis posterior.

A PCR cuantitativa mostrou varias tendencias que teñen que ver coa colinearidade: o sistema está en equilibrio e o número total de transcritos depende do número de xenes presente segundo unha relación linear.[26]

Colinearidade[editar | editar a fonte]

Nalgúns organismos, especialmente vertebrados, os diversos xenes Hox están situados moi preto uns dos outros no cromosoma en grupos ou clusters. A orde dos xenes no cromosoma é a mesma que a orde de expresión dos xenes no embrión en desenvolvemento; o primeiro xene exprésase no extremo anterior do eixe do organismo en desenvolvemento. A razón desta colinearidade non se comprende aínda ben. O diagrama de arriba mostra as relacións entre os xenes e expresión das proteínas nas moscas.

Nomenclatura[editar | editar a fonte]

Os xenes Hox noméanse polos fenotipos homeóticos que resultan cando a súa función se altera, alí onde un segmento se desenvolve coa identidade doutro (por exemplo, patas onde debería haber antenas). Os xenes Hox de diferentes filos recibiron distintos nomes, o cal levou a unha confusión na nomenclatura. O complemento de xenes Hox de Drosophila está constituído por dous agrupamentos ou clusters, o complexo Antennapedia e o Bithorax, que xuntos foron denominados historicamente HOM-C (o Complexo Homeótico). Aínda que historiacmente os xenes HOM-C se referían a xenes homólogos de Drosophila, mentres que os xenes Hox se referían a homólogos de vertebrados, esta distinción xa non se fai, e tanto os xenes HOM-C coma os Hox denomínnse agora xenes Hox.

Noutras especies[editar | editar a fonte]

Vertebrados[editar | editar a fonte]

Os ratos e os humanos teñen 38 xenes Hox dispostos en catro agrupamentos ou clusters chamados

Cluster Cromosoma Xenes
HOXA@ cromosoma 7 HOXA1, HOXA2, HOXA3, HOXA4, HOXA5, HOXA6, HOXA7, HOXA9, HOXA10, HOXA11, HOXA13
HOXB@ cromosoma 17 HOXB1, HOXB2, HOXB3, HOXB4, HOXB5, HOXB6, HOXB7, HOXB8, HOXB9, HOXB13
HOXC@ cromosoma 12 HOXC4, HOXC5, HOXC6, HOXC8, HOXC9, HOXC10, HOXC11, HOXC12, HOXC13
HOXD@ cromosoma 2 HOXD1, HOXD3, HOXD4, HOXD8, HOXD9, HOXD10, HOXD11, HOXD12, HOXD13

Os mamíferos, aves e a maioría dos peixes teñen catro agrupamentos HOX.[27] O peixe cebra ten unha copia adicional de HoxA, HoxB e HoxC, totalizando sete clusters.[27] Un só microARN marca a localización dunha copia perdida de HoxD, presente noutros peixes teleósteos.[29]

Os xenes Hox, especialmente os clusters HoxA e HoxD, están implicados nas capacidades de rexeneración de extremidades de anfibios e réptiles.[30]

Anfioxo[editar | editar a fonte]

Os anfioxos como Branchiostoma floridae teñen un só cluster Hox con 14 xenes, chamados con números sucesivos desde AmphiHox1 a AmphiHox14.[31]

Historia[editar | editar a fonte]

Os xenes Hox son así nomeados porque as mutacións que os afectan causan transformacións homeóticas. As transformacións homeóticas foron primeiro identificadas e estudadas por William Bateson en 1894, que acuñou o termo "homeose". Despois do redescubrimento dos principios xenéticos de Mendel, Bateson e outros decatáronse que algúns exemplos de homeose en órganos florais e esqueletos animais podería atribuírse a variacións nos xenes.

A evidencia definitiva para unha base xenética dalgunhas transformacións homeóticas era obtida illando os mutantes homeóticos. O primeiro mutante homeótico atopouno Calvin Bridges no laboratorio de Thomas Hunt Morgan en 1915. Este mutante mostra unha duplicaión parcial do tórax e era, por tanto, nomeado Bithorax (bx). Transforma o terceiro segmento torácico (T3) cara ao segundo (T2). A mutación Bithorax orixinouse espontaneamente no laboratorio e foi mantida como un stock de laboratorio desde entón.[32]

Os estudos xenéticos de Morgan e outros proporcionaron os fundamentos para análise sistemática de Edward B. Lewis e Thomas Kaufman, que proporcionou definicións preliminares de moitos xenes homeóticos dos complexos Bithorax e Antennapedia, e tamén mostraron que os fenotipos mutantes para a maioría destes xenes poderían ser rastreados a defectos no padrón do plan corporal embrionario.

Ed Lewis, Christiane Nüsslein-Volhard e Eric F. Wieschaus identificaron e clasificaron 15 xenes de importancia clave para determinar o plan corporal e a formación de segmentos corporais da mosca da froita Drosophila melanogaster en 1980.[33] Polos seus traballos, Lewis, Nüsslein-Volhard e Wieschaus foron galardoados co Premio Nobel de Fisioloxía ou Medicina en 1995.[34]

En 1983, o homeobox foi decuberto independentemente por investigadores de dous laboratorios: Ernst Hafen, Michael Levine e William McGinnis (no laboratorio de Walter Gehring na Universidade de Basilea, Suíza) e Matthew P. Scott e Amy Weiner (no laboratorio de Thomas Kaufman na Universidade de Indiana en Bloomington).

Notas[editar | editar a fonte]

  1. Pearson, Joseph C.; Lemons, Derek; McGinnis, William. "Modulating Hox gene functions during animal body patterning". Nature Reviews Genetics 6: 893–904. doi:10.1038/nrg1726. 
  2. Carroll S. B. (1995). "Homeotic genes and the evolution of arthropods and chordates". Nature 376 (6540): 479–85. PMID 7637779. doi:10.1038/376479a0. 
  3. http://www.csb.ki.se/groups/tbu/homeo/consensus.gif
  4. McGinnis W.; R. Krumlauf (1992). "Homeobox genes and axial patterning". Cell 68 (2): 283–302. PMID 1346368. doi:10.1016/0092-8674(92)90471-N. 
  5. Lutz, B.; H.C. Lu; G. Eichele; D. Miller; T.C. Kaufman (1996). "Rescue of Drosophila labial null mutant by the chicken ortholog Hoxb-1 demonstrates that the function of Hox genes is phylogenetically conserved". Genes & Development 10 (2): 176–184. PMID 8566751. doi:10.1101/gad.10.2.176. 
  6. Ayala, F.J.; A. Rzhetskydagger (20 January 1998). "Origin of the metazoan phyla: Molecular clocks confirm paleontological estimates". Proc. Natl. Acad. Sci. USA 95 (2): 606–11. PMC 18467. PMID 9435239. doi:10.1073/pnas.95.2.606. 
  7. 7,0 7,1 7,2 Hox genes and the evolution of the arthropod body plan. Hughes CL, Kaufman TC. Evol Dev. 2002 Nov-Dec;4(6):459-99.
  8. 8,0 8,1 8,2 Brody, Thomas (1996). "The Interactive Fly". 
  9. Regulski M, McGinnis N, Chadwick R, McGinnis W (March 1987). "Developmental and molecular analysis of Deformed; a homeotic gene controlling Drosophila head development". EMBO J. 6 (3): 767–77. PMC 553462. PMID 16453752. 
  10. Pattatucci AM, Kaufman TC (October 1991). "The homeotic gene Sex combs reduced of Drosophila melanogaster is differentially regulated in the embryonic and imaginal stages of development". Genetics 129 (2): 443–61. PMC 1204635. PMID 1683847. 
  11. Hueber S.D.; Weiller, G.F.; Djordjevic, M. A.; Frickey, T. (2010). "Improving Hox Protein Classification across the Major Model Organisms". PLoS ONE 5 (5): e10820. PMC 2876039. PMID 20520839. doi:10.1371/journal.pone.0010820. 
  12. Hueber S.D.; Rauch J.; Djordjevic M.A.; Gunter H.; Weiller G.F.; Frickey T. (2013). "Analysis of central Hox protein types across bilaterian clades: On the diversification of central Hox proteins from an Antennapedia/Hox7-like protein". Developmental Biology 383 (2): 175–185. PMID 24055174. doi:10.1016/j.ydbio.2013.09.009. 
  13. 13,0 13,1 Pearson, JC; Lemons, D.; McGinnis, W. (2005). "Modulating Hox gene functions during animal body patterning". Nature Reviews Genetics 6: 893–904. doi:10.1038/nrg1726. 
  14. 14,0 14,1 Vachon, G.; et al. (1992). "Homeotic genes of the bithorax complex repress limb development in the abdomen of the Drosophila embryo through the target gene Distal-less". Cell 71: 437–450. doi:10.1016/0092-8674(92)90513-C. 
  15. 15,0 15,1 Capovilla, M.; Botas, J. (1998). "Functional dominance among Hox genes: repression dominates activation in the regulation of dpp". Development 125: 4949–4957. 
  16. Lohmann, I.; McGinnis, N.; Bodmer, M.; McGinnis, W. (2002). "The Drosophila Hox gene Deformed sculpts head morphology via direct regulation of the apoptosis activator reaper". Cell 110: 457–466. doi:10.1016/s0092-8674(02)00871-1. 
  17. Bromleigh, V. C.; Freedman, L. P. (2000). "p21 is a transcriptional target of HOXA10 in differentiating myelomonocytic cells". Genes Dev. 14: 2581–2586. doi:10.1101/gad.817100. 
  18. Gilbert, Developmental Biology, 2006
  19. Hanes and Brent 1989, 1991
  20. Mann, Richard S.; Lelli, Katherine M.; Joshi, Rohit (2009). "Chapter 3 Hox Specificity: Unique Roles for Cofactors and Collaborators". Current Topics in Developmental Biology 88: 63–101. doi:10.1016/S0070-2153(09)88003-4. 
  21. Small, S; Blair, A; Levine, M (Nov 1992). "Regulation of even-skipped stripe 2 in the Drosophila embryo". EMBO J 11 (11): 4047–57. 
  22. Lempradl, A; Ringrose, L (2008). "How does noncoding transcription regulate Hox genes?". BioEssays 30 (2): 110–21. doi:10.1002/bies.20704. 
  23. Rinn, JL; Kertesz, M; Wang, JK; Squazzo, SL; Xu, X; Brugmann, SA; Goodnough, LH; Helms, JA; et al. (2007). "Functional Demarcation of Active and Silent Chromatin Domains in Human HOX Loci by Non-Coding RNAs". Cell 129 (7): 1311–23. PMC 2084369. PMID 17604720. doi:10.1016/j.cell.2007.05.022. 
  24. Fraser, P; Bickmore, W. (2007). "Nuclear organization of the genome and the potential for gene regulation". Nature 447 (7143): 413–7. PMID 17522674. doi:10.1038/nature05916. 
  25. Duester, G (September 2008). "Retinoic Acid Synthesis and Signaling during Early Organogenesis". Cell 134 (6): 921–31. PMC 2632951. PMID 18805086. doi:10.1016/j.cell.2008.09.002. 
  26. Montavon; Le Garrec, JF; Kerszberg, M; Duboule, D (2008). "Modeling Hox gene regulation in digits: reverse collinearity and the molecular origin of thumbness". Genes Dev. 22 (3): 346–59. PMC 2216694. PMID 18245448. doi:10.1101/gad.1631708. 
  27. 27,0 27,1 27,2 Lappin, TR; Grier, DG; Thompson, A; Halliday, HL (January 2006). "HOX genes: seductive science, mysterious mechanisms.". The Ulster medical journal 75 (1): 23–31. PMC 1891803. PMID 16457401. 
  28. "Vertebrate homeobox gene nomenclature". Cell (en inglés) 71 (4): 551–553. 13 November 1992. ISSN 0092-8674. doi:10.1016/0092-8674(92)90588-4. 
  29. Woltering, Joost M; Durston, Antony J (1 June 2006). "The zebrafish hoxDb cluster has been reduced to a single microRNA". Nature Genetics 38 (6): 601–602. doi:10.1038/ng0606-601. 
  30. Mullen, L. M., Bryant, S. V., Torok, M. A., Blumberg, B., & Gardiner, D. M. (1996). "Nerve dependency of regeneration: the role of Distal-less and FGF signaling in amphibian limb regeneration." Development (Cambridge, England), 122(11), 3487–3497.
  31. Minguillón, Carolina; Gardenyes, Josep; Serra, Elisa; Castro, L. Filipe C.; Hill-Force, Alicia; Holland, Peter W.H.; Amemiya, Chris T.; Garcia-Fernàndez, Jordi (5 January 2005). "No more than 14: the end of the amphioxus Hox cluster". International Journal of Biological Sciences 1 (1): 19–23. ISSN 1449-2288. 
  32. Gehring, Walter J. (1998). Master Control Genes in Development and Evolution: The Homeobox Story. Yale Univ. Press. 
  33. Nüsslein-Volhard, Christiane; Wieschaus, Eric (30 October 1980). "Mutations affecting segment number and polarity in Drosophila" (PDF). Nature 287 (5785): 795–801. doi:10.1038/287795a0. 
  34. "The Nobel Prize in Physiology or Medicine 1995". Nobelprize.org. 

Véxase tamén[editar | editar a fonte]

Outros artigos[editar | editar a fonte]

Bibliografía[editar | editar a fonte]

Ligazóns externas[editar | editar a fonte]