Proteína similar á ubiquitina procariótica

Na Galipedia, a Wikipedia en galego.
Saltar ata a navegación Saltar á procura

A proteína similar á ubiquitina procariótica ou Pup (do inglés Prokaryotic ubiquitin-like protein) é unha proteína análoga funcional da ubiquitina, que se encontra en procariotas (descubriuse en Mycobacterium tuberculosis).[1] Realiza a mesma función que a ubiquitina, aínda que a encimoloxía da ubiquitilación e a pupilación é diferente. A diferenza da reacción da ubiquitilación, que consta de tres pasos, a pupilación realízase só en dous pasos, e, por tanto, interveñen só dous encimas. Igual que a ubiquitina, a Pup únese a residuos de lisina específicos de proteínas substrato para formar enlaces isopéptidos, de modo que a proteína queda marcada por esta pupilación. Despois, a proteína modificada é recoñecida pola ATPase proteasómica de Mycobacterium (Mpa) por medio dun mecanismo de pregamento inducido pola unión[2] no que se forma unha hélice alfa na Pup; despois a Mpa cede o substrato pupilado ao proteasoma de 20S ao acoplar a hidrólise do ATP para que se produza a súa degradación no proteasoma. Por tanto, igual que en eucariotas, as bacterias poden usar unha pequena proteína modificadora para controlar a estabilidade das proteínas. A estrutura cristalina de raios X do complexo Pup/Mpa ( PDB 3M9D ) foi determinada por primeira vez polos científicos Tao Wang e Huilin Li no Laboratorio Nacional de Brookhaven de EUA.

Familia das proteínas similares á ubiquitina
Pup-prokaryotic ubiquitin-like protein.png
Tres proteínas similares á ubiquitina procariótica (en azul) unidas á ATPase proteasómica Mpa (en vermello)
Identificadores
Símbolo Pup/Mpa PDB:3M9D
Pfam PF05639

O xene Pup codifica unha proteína de 64 aminoácidos cun peso molecular de 6.944 kDa. A secuencia é a seguinte:

MAQEQTKRGGGGGDDDDIAGSTAAGQERREKLTEETDDLLDEIDDVLEENAEDFVRAYVQKGGQ[3]

Base de datos[editar | editar a fonte]

PupDB é unha base de datos de proteínas pupiladas e sitios de pupilación.[4]

Notas[editar | editar a fonte]

  1. Pearce, M. J.; Mintseris, J.; Ferreyra, J.; Gygi, S. P.; Darwin, K. H. (2008). "Ubiquitin-Like Protein Involved in the Proteasome Pathway of Mycobacterium tuberculosis". Science 322 (5904): 1104–1107. PMC 2698935. PMID 18832610. doi:10.1126/science.1163885. 
  2. Wang T, Darwin KH, Li H. Binding-induced folding of prokaryotic ubiquitin-like protein on the Mycobacterium proteasomal ATPase targets substrates for degradation.Nat Struct Mol Biol. 2010 Nov;17(11):1352-7. doi: 10.1038/nsmb.1918.
  3. http://www.uniprot.org/uniprot/P9WHN4#section_seq
  4. Tung, Chun-Wei (1 January 2012). "PupDB: a database of pupylated proteins". BMC Bioinformatics 13 (1): 40. doi:10.1186/1471-2105-13-40. 

Véxase tamén[editar | editar a fonte]

Outros artigos[editar | editar a fonte]